PDB entry 2oj4

View 2oj4 on RCSB PDB site
Description: Crystal structure of RGS3 RGS domain
Class: signaling protein inhibitor
Keywords: protein; rgs domain, signaling protein inhibitor
Deposited on 2007-01-12, released 2007-01-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2oj4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oj4A (A:)
    seealkwgeslekllvhkyglavfqaflrtefseenlefwlacedfkkvksqskmaskak
    kifaeyiaiqackevnldsytrehtkdnlqsvtrgcfdlaqkrifglmekdsyprflrsd
    lyldlin