PDB entry 2oig

View 2oig on RCSB PDB site
Description: Crystal structure of RS21-C6 core segment and dm5CTP complex
Class: hydrolase
Keywords: helix, protein-nucleoside triphosphate complex, substrate complex, hydrolase
Deposited on 2007-01-11, released 2007-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rs21-c6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oiga1
  • Chain 'B':
    Compound: rs21-c6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oigb1
  • Chain 'C':
    Compound: rs21-c6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oigc1
  • Chain 'D':
    Compound: rs21-c6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oigd1
  • Heterogens: 523, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oigA (A:)
    gplgsrpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwks
    dtepgpqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oigA (A:)
    pfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepgp
    qawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oigB (B:)
    gplgsrpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwks
    dtepgpqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oigB (B:)
    rpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepg
    pqawppkeraalqeelsdvliylvalaarchvdlpqaviskm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oigC (C:)
    gplgsrpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwks
    dtepgpqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oigC (C:)
    pfrfspeptledirrlhaqfhqprnlllalvgevgelaelfqwksdtgpqawppkeraal
    qeelsdvliylvalaarchvdlpqaviskm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oigD (D:)
    gplgsrpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwks
    dtepgpqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oigD (D:)
    rpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepg
    pqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdt