PDB entry 2oi9

View 2oi9 on RCSB PDB site
Description: Structure of the 2C/Ld/QL9 allogeneic complex
Class: immune system
Keywords: tcr, MHC, immune system
Deposited on 2007-01-10, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.221
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major Histocompatibility Complex protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: T cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oi9b_
  • Chain 'C':
    Compound: T cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oi9c_
  • Chain 'Q':
    Compound: peptide (GLN)(LEU)(SER)(PRO)(PHE)(PRO)(PHE)(ASP)(LEU)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2OI9 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oi9B (B:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhrsdsavyfcavsgfasaltfgsgtkvivlpyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oi9B (B:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhrsdsavyfcavsgfasaltfgsgtkvivl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oi9C (C:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvlssalehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oi9C (C:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls
    

  • Chain 'Q':
    No sequence available.