PDB entry 2oi6

View 2oi6 on RCSB PDB site
Description: E. coli GlmU- Complex with UDP-GlcNAc, CoA and GlcN-1-PO4
Class: transferase
Keywords: left-handed beta helix
Deposited on 2007-01-10, released 2007-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-19, with a file datestamp of 2007-06-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Escherichia coli
    Gene: glmU
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2oi6a1, d2oi6a2
  • Chain 'B':
    Compound: Bifunctional protein glmU
    Species: Escherichia coli
    Gene: glmU
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2oi6b1, d2oi6b2
  • Heterogens: GP1, MG, CO, SO4, COA, UD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oi6A (A:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgsk
    aghltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgat
    iaagttvtrnvgenalaisrvpqtqkegwrrpvkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oi6A (A:)
    namsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdllk
    qalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakpq
    ggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkrw
    lakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqseq
    aeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvi
    gddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskagh
    ltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaa
    gttvtrnvgenalaisrvpqtqkegwrrpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oi6B (B:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgsk
    aghltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgat
    iaagttvtrnvgenalaisrvpqtqkegwrrpvkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oi6B (B:)
    nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
    kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
    qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
    wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
    qaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsv
    igddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskag
    hltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatia
    agttvtrnvgenalaisrvpqtqkegwrrpvk