PDB entry 2oi5

View 2oi5 on RCSB PDB site
Description: E. coli GlmU- Complex with UDP-GlcNAc and Acetyl-CoA
Class: transferase
Keywords: left-handed beta helix, transferase
Deposited on 2007-01-10, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Escherichia coli [TaxId:562]
    Gene: glmU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oi5a1, d2oi5a2
  • Chain 'B':
    Compound: Bifunctional protein glmU
    Species: Escherichia coli [TaxId:562]
    Gene: glmU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oi5b1, d2oi5b2
  • Heterogens: MG, SO4, ACO, UD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oi5A (A:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgsk
    aghltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgat
    iaagttvtrnvgenalaisrvpqtqkegwrrpvkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oi5A (A:)
    namsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdllk
    qalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakpq
    ggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkrw
    lakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqseq
    aeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvi
    gddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskagh
    ltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaa
    gttvtrnvgenalaisrvpqtqkegwrrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oi5B (B:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgsk
    aghltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgat
    iaagttvtrnvgenalaisrvpqtqkegwrrpvkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oi5B (B:)
    nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
    kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
    qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
    wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
    qaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsv
    igddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskag
    hltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatia
    agttvtrnvgenalaisrvpqtqkegwrrp