PDB entry 2ohx

View 2ohx on RCSB PDB site
Description: refined crystal structure of liver alcohol dehydrogenase-nadh complex at 1.8 angstroms resolution
Class: oxidoreductase(nad(a)-choh(d))
Keywords: oxidoreductase(nad(a)-choh(d))
Deposited on 1993-08-24, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ohxa1, d2ohxa2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ohxb1, d2ohxb2
  • Heterogens: ZN, NAD, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ohxA (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ohxB (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf