PDB entry 2ohs

View 2ohs on RCSB PDB site
Description: X-ray crystal structure of beta secretase complexed with compound 6b
Class: hydrolase
Keywords: alternative splicing, alzheimer's disease, aspartic protease, aspartyl protease, base, beta-secretase, glycoprotein, hydrolase, memapsin 2, signal, transmembrane, zymogen
Deposited on 2007-01-10, released 2007-03-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ohsa_
  • Heterogens: IOD, DMS, 9IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ohsA (A:)
    retdeepeepgkkgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaa
    phpflhryyqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaait
    esdkffingsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnq
    sevlasvggsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynyd
    ksivdsgttnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvi
    slylmgevtnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyv
    vfdrarkrigfavsachvhdefrtaavegpfvtldmedcgyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohsA (A:)
    fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
    tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
    lglayaeiarpddslepffdslvkqthvpnlfslqlcgaggsmiiggidhslytgslwyt
    pirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksikaa
    sstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrpved
    vatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaave
    gpfvtldmedcgyn