PDB entry 2ohi

View 2ohi on RCSB PDB site
Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, reduced state
Class: oxidoreductase
Keywords: beta-lactamase like domain, flavodoxine like domain, OXIDOREDUCTASE
Deposited on 2007-01-10, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ohia1, d2ohia2
  • Chain 'B':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ohib1, d2ohib2
  • Chain 'D':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ohid1, d2ohid2
  • Chain 'E':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ohie1, d2ohie2
  • Chain 'G':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ohig1, d2ohig2
  • Chain 'H':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ohih1, d2ohih2
  • Chain 'I':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ohii1, d2ohii2
  • Chain 'J':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ohij1, d2ohij2
  • Heterogens: FE, CL, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ohiA (A:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohiA (A:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ohiB (B:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohiB (B:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ohiD (D:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohiD (D:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ohiE (E:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohiE (E:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ohiG (G:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohiG (G:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ohiH (H:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohiH (H:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ohiI (I:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohiI (I:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ohiJ (J:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohiJ (J:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir