PDB entry 2ohh

View 2ohh on RCSB PDB site
Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, active oxidized state
Class: oxidoreductase
Keywords: beta-lactamase like domain, flavodoxine like domain, OXIDOREDUCTASE
Deposited on 2007-01-10, released 2007-05-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ohha1, d2ohha2
  • Chain 'B':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ohhb1, d2ohhb2
  • Chain 'D':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ohhd1
  • Chain 'E':
    Compound: Type A flavoprotein fprA
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: fprA, fpaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ohhe1, d2ohhe2
  • Heterogens: FE, SO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ohhA (A:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohhA (A:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ohhB (B:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohhB (B:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ohhD (D:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohhD (D:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ohhE (E:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ohhE (E:)
    mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
    marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
    lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
    rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
    mkiieaytgwatgmvdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrse
    ivkdilesgaialgaptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatg
    tmkellaeagfdvaceeevyyvptgdeldacfeagrklaaeir