PDB entry 2oh8

View 2oh8 on RCSB PDB site
Description: Myoglobin cavity mutant I28W
Class: oxygen storage/transport
Keywords: myoglobin, ligand entry and exit pathways, oxygen storage/transport complex
Deposited on 2007-01-09, released 2007-01-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • initiating methionine (0)
      • engineered (28)
      • conflict (122)
    Domains in SCOPe 2.01: d2oh8a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oh8A (A:)
    mvlsegewqlvlhvwakveadvaghgqdwlirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg