PDB entry 2oh8

View 2oh8 on RCSB PDB site
Description: Myoglobin cavity mutant I28W
Class: oxygen storage/transport
Keywords: myoglobin, ligand entry and exit pathways, oxygen storage/transport complex
Deposited on 2007-01-09, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • initiating methionine (0)
    • engineered (28)
    • conflict (122)
  Domains in SCOPe 2.08: d2oh8a_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oh8A (A:)
  mvlsegewqlvlhvwakveadvaghgqdwlirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg