PDB entry 2ogv

View 2ogv on RCSB PDB site
Description: Crystal Structure of the Autoinhibited Human c-Fms Kinase Domain
Class: transferase
Keywords: receptor tyrosine kinase, macrophage colony stimulating factor receptor, transferase
Deposited on 2007-01-09, released 2007-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage colony-stimulating factor 1 receptor precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: CSF1R, FMS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ogva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ogvA (A:)
    kpkyqvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlgagafgkvveataf
    glgkedavlkvavkmlkstahadekealmselkimshlgqhenivnllgacthggpvlvi
    teyccygdllnflrrkaeadldkedgrplelrdllhfssqvaqgmaflaskncihrdvaa
    rnvlltnghvakigdfglardimndsnyivkgnarlpvkwmapesifdcvytvqsdvwsy
    gillweifslglnpypgilvnskfyklvkdgyqmaqpafapkniysimqacwalepthrp
    tfqqicsflqeqaqedr