PDB entry 2ogr

View 2ogr on RCSB PDB site
Description: Crystal Structure of Yellow Fluorescent Protein from Zoanthus sp. at 1.8 A Resolution
Class: fluorescent protein
Keywords: GFP-like proteins, yellow fluorescent protein, Zoanthus sp., chromophore structure, tetramer structure, intermonomer interfaces
Deposited on 2007-01-08, released 2007-09-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fluorescent protein fp538
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y4 (Start-230)
      • modified residue (64)
      • chromophore (65)
    Domains in SCOPe 2.03: d2ogra_
  • Chain 'B':
    Compound: fluorescent protein fp538
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y4 (Start-230)
      • modified residue (64)
      • chromophore (65)
    Domains in SCOPe 2.03: d2ogrb_
  • Chain 'C':
    Compound: fluorescent protein fp538
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y4 (Start-230)
      • modified residue (64)
      • chromophore (65)
    Domains in SCOPe 2.03: d2ogrc_
  • Chain 'D':
    Compound: fluorescent protein fp538
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y4 (Start-230)
      • modified residue (64)
      • chromophore (65)
    Domains in SCOPe 2.03: d2ogrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ogrA (A:)
    mahskhglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedi
    lsagfkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenci
    yhksifngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcq
    fdtvykaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogrA (A:)
    hglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsagf
    kygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhksi
    fngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtvy
    kaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ogrB (B:)
    mahskhglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedi
    lsagfkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenci
    yhksifngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcq
    fdtvykaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogrB (B:)
    hglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsagf
    kygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhksi
    fngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtvy
    kaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ogrC (C:)
    mahskhglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedi
    lsagfkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenci
    yhksifngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcq
    fdtvykaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogrC (C:)
    hglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsagf
    kygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhksi
    fngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtvy
    kaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ogrD (D:)
    mahskhglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedi
    lsagfkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenci
    yhksifngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcq
    fdtvykaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogrD (D:)
    hglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsagf
    kygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhksi
    fngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtvy
    kaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala