PDB entry 2ogo

View 2ogo on RCSB PDB site
Description: The crystal structure of the large ribosomal subunit from Deinococcus radiodurans complexed with the pleuromutilin derivative retapamulin (SB-275833)
Class: ribosome
Keywords: retapamulin, SB-275833, pleuromutilin, PTC, peptidyl transferase center, ribosome, antibiotic
Deposited on 2007-01-07, released 2007-05-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.66 Å
R-factor: 0.26
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23S ribosomal RNA
    Species: Deinococcus radiodurans [TaxId:1299]
  • Chain 'B':
    Compound: 50S ribosomal protein L3
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ogob1
  • Heterogens: G34

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ogoB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakasaakggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogoB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakas