PDB entry 2oga

View 2oga on RCSB PDB site
Description: X-ray crystal structure of S. venezuelae DesV in complex with ketimine intermediate
Class: hydrolase
Keywords: PLP-dependent enzyme, desosamine, transaminase, deoxysugars, antibiotics, HYDROLASE
Deposited on 2007-01-05, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaminase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: desV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ogaa_
  • Chain 'B':
    Compound: Transaminase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: desV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ogab_
  • Chain 'C':
    Compound: Transaminase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: desV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ogac_
  • Chain 'D':
    Compound: Transaminase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: desV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ogad_
  • Heterogens: CL, NA, EDO, PGU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ogaA (A:)
    mgsshhhhhhssenlyfqghmssraetprvpfldlkaayeelraetdaaiarvldsgryl
    lgpelegfeaefaaycetdhavgvnsgmdalqlalrglgigpgdevivpshtyiaswlav
    satgatpvpvephedhptldpllvekaitprtrallpvhlyghpadmdalreladrhglh
    ivedaaqahgaryrgrrigagssvaafsfypgknlgcfgdggavvtgdpelaerlrmlrn
    ygsrqkyshetkgtnsrldemqaavlrirlahldswngrrsalaaeylsglaglpgiglp
    vtapdtdpvwhlftvrterrdelrshldargidtlthypvpvhlspayageappegslpr
    aesfarqvlslpigphlerpqalrvidavrewaervdqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogaA (A:)
    tprvpfldlkaayeelraetdaaiarvldsgryllgpelegfeaefaaycetdhavgvns
    gmdalqlalrglgigpgdevivpshtyiaswlavsatgatpvpvephedhptldpllvek
    aitprtrallpvhlyghpadmdalreladrhglhivedaaqahgaryrgrrigagssvaa
    fsfypgknlgcfgdggavvtgdpelaerlrmlrnygsrqkyshetkgtnsrldemqaavl
    rirlahldswngrrsalaaeylsglaglpgiglpvtapdtdpvwhlftvrterrdelrsh
    ldargidtlthypvpvhlspayageappegslpraesfarqvlslpigphlerpqalrvi
    davrewaervd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ogaB (B:)
    mgsshhhhhhssenlyfqghmssraetprvpfldlkaayeelraetdaaiarvldsgryl
    lgpelegfeaefaaycetdhavgvnsgmdalqlalrglgigpgdevivpshtyiaswlav
    satgatpvpvephedhptldpllvekaitprtrallpvhlyghpadmdalreladrhglh
    ivedaaqahgaryrgrrigagssvaafsfypgknlgcfgdggavvtgdpelaerlrmlrn
    ygsrqkyshetkgtnsrldemqaavlrirlahldswngrrsalaaeylsglaglpgiglp
    vtapdtdpvwhlftvrterrdelrshldargidtlthypvpvhlspayageappegslpr
    aesfarqvlslpigphlerpqalrvidavrewaervdqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogaB (B:)
    tprvpfldlkaayeelraetdaaiarvldsgryllgpelegfeaefaaycetdhavgvns
    gmdalqlalrglgigpgdevivpshtyiaswlavsatgatpvpvephedhptldpllvek
    aitprtrallpvhlyghpadmdalreladrhglhivedaaqahgaryrgrrigagssvaa
    fsfypgknlgcfgdggavvtgdpelaerlrmlrnygsrqkyshetkgtnsrldemqaavl
    rirlahldswngrrsalaaeylsglaglpgiglpvtapdtdpvwhlftvrterrdelrsh
    ldargidtlthypvpvhlspayageappegslpraesfarqvlslpigphlerpqalrvi
    davrewaerv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ogaC (C:)
    mgsshhhhhhssenlyfqghmssraetprvpfldlkaayeelraetdaaiarvldsgryl
    lgpelegfeaefaaycetdhavgvnsgmdalqlalrglgigpgdevivpshtyiaswlav
    satgatpvpvephedhptldpllvekaitprtrallpvhlyghpadmdalreladrhglh
    ivedaaqahgaryrgrrigagssvaafsfypgknlgcfgdggavvtgdpelaerlrmlrn
    ygsrqkyshetkgtnsrldemqaavlrirlahldswngrrsalaaeylsglaglpgiglp
    vtapdtdpvwhlftvrterrdelrshldargidtlthypvpvhlspayageappegslpr
    aesfarqvlslpigphlerpqalrvidavrewaervdqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogaC (C:)
    prvpfldlkaayeelraetdaaiarvldsgryllgpelegfeaefaaycetdhavgvnsg
    mdalqlalrglgigpgdevivpshtyiaswlavsatgatpvpvephedhptldpllveka
    itprtrallpvhlyghpadmdalreladrhglhivedaaqahgaryrgrrigagssvaaf
    sfypgknlgcfgdggavvtgdpelaerlrmlrnygsrqkyshetkgtnsrldemqaavlr
    irlahldswngrrsalaaeylsglaglpgiglpvtapdtdpvwhlftvrterrdelrshl
    dargidtlthypvpvhlspayageappegslpraesfarqvlslpigphlerpqalrvid
    avrewaerv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ogaD (D:)
    mgsshhhhhhssenlyfqghmssraetprvpfldlkaayeelraetdaaiarvldsgryl
    lgpelegfeaefaaycetdhavgvnsgmdalqlalrglgigpgdevivpshtyiaswlav
    satgatpvpvephedhptldpllvekaitprtrallpvhlyghpadmdalreladrhglh
    ivedaaqahgaryrgrrigagssvaafsfypgknlgcfgdggavvtgdpelaerlrmlrn
    ygsrqkyshetkgtnsrldemqaavlrirlahldswngrrsalaaeylsglaglpgiglp
    vtapdtdpvwhlftvrterrdelrshldargidtlthypvpvhlspayageappegslpr
    aesfarqvlslpigphlerpqalrvidavrewaervdqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogaD (D:)
    tprvpfldlkaayeelraetdaaiarvldsgryllgpelegfeaefaaycetdhavgvns
    gmdalqlalrglgigpgdevivpshtyiaswlavsatgatpvpvephedhptldpllvek
    aitprtrallpvhlyghpadmdalreladrhglhivedaaqahgaryrgrrigagssvaa
    fsfypgknlgcfgdggavvtgdpelaerlrmlrnygsrqkyshetkgtnsrldemqaavl
    rirlahldswngrrsalaaeylsglaglpgiglpvtapdtdpvwhlftvrterrdelrsh
    ldargidtlthypvpvhlspayageappegslpraesfarqvlslpigphlerpqalrvi
    davrewaerv