PDB entry 2og8

View 2og8 on RCSB PDB site
Description: crystal structure of aminoquinazoline 36 bound to Lck
Class: transferase
Keywords: Lck, Kinase domain, TRANSFERASE
Deposited on 2007-01-05, released 2007-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.247
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2og8a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (1-263)
      • cloning artifact (0)
      • cloning artifact (264)
    Domains in SCOPe 2.06: d2og8b2, d2og8b3, d2og8b4
  • Heterogens: 1N8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2og8A (A:)
    dewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkql
    qhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafi
    eernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainyg
    tftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrl
    cwkerpedrptfdylrsvledffta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2og8A (A:)
    ewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlq
    hqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafie
    ernyihrdlraanilvsdtlsckiadfglpikwtapeainygtftiksdvwsfgilltei
    vthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrptfdylrsv
    ledfft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2og8B (B:)
    dewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkql
    qhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafi
    eernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainyg
    tftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrl
    cwkerpedrptfdylrsvledffta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2og8B (B:)
    dewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkql
    qhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafi
    eernyihrdlraanilvsdtlsckiadfglapikwtapeainygtftiksdvwsfgillt
    eivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrptfdylr
    svledffta