PDB entry 2og0
View 2og0 on RCSB PDB site
Description: Crystal Structure of the Lambda Xis-DNA complex
Class: DNA binding protein/DNA
Keywords: protein-DNA complex,
DNA architectural protein, 'winged'helix protein,
phage excision,
site-specific recombination
recombination
Deposited on
2007-01-04, released
2007-03-13
The last revision prior to the SCOP 1.75 freeze date was dated
2007-03-13, with a file datestamp of
2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.55
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Excisionase
Species: Bacteriophage lambda
Gene: Xis
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2og0a1 - Chain 'B':
Compound: Excisionase
Species: Bacteriophage lambda
Gene: Xis
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2og0b1 - Chain 'C':
Compound: 5'-d(*gp*tp*ap*tp*tp*ap*tp*gp*tp*ap*gp*tp*cp*tp*gp*tp*tp*t)-3'
- Chain 'D':
Compound: 5'-d(*ap*ap*ap*cp*ap*gp*ap*cp*tp*ap*cp*ap*tp*ap*ap*tp*ap*c)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2og0A (A:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdl
Sequence, based on observed residues (ATOM records): (download)
>2og0A (A:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2og0B (B:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdl
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.