PDB entry 2og0

View 2og0 on RCSB PDB site
Description: Crystal Structure of the Lambda Xis-DNA complex
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, DNA architectural protein, 'winged'helix protein, phage excision, site-specific recombination recombination
Deposited on 2007-01-04, released 2007-03-13
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Excisionase
  Species: Bacteriophage lambda
  Gene: Xis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03699 (0-End)
    • engineered (27)
  Domains in SCOP 1.73: d2og0a1
• Chain 'B':
  Compound: Excisionase
  Species: Bacteriophage lambda
  Gene: Xis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03699 (0-51)
    • engineered (27)
  Domains in SCOP 1.73: d2og0b1
• Chain 'C':
  Compound: 5'-d(*gp*tp*ap*tp*tp*ap*tp*gp*tp*ap*gp*tp*cp*tp*gp*tp*tp*t)-3'
  
• Chain 'D':
  Compound: 5'-d(*ap*ap*ap*cp*ap*gp*ap*cp*tp*ap*cp*ap*tp*ap*ap*tp*ap*c)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2og0A (A:)
  myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2og0A (A:)
  myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2og0B (B:)
  myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdl
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.