PDB entry 2ofx

View 2ofx on RCSB PDB site
Description: crystal structure of the APSK domain of human PAPSS1 in complex with ADPMg and PAPS
Class: transferase
Keywords: nucleotide kinase, TRANSFERASE
Deposited on 2007-01-04, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-206)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d2ofxa1, d2ofxa2
  • Chain 'B':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-206)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d2ofxb1, d2ofxb2
  • Heterogens: MG, PO4, PPS, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ofxA (A:)
    qghmatnvtyqahhvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchg
    ipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrn
    narqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapel
    vlktdscdvndcvqqvvellqerdivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofxA (A:)
    hmatnvtyqahhvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgip
    cytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnna
    rqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvl
    ktdscdvndcvqqvvellqerdivp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ofxB (B:)
    qghmatnvtyqahhvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchg
    ipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrn
    narqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapel
    vlktdscdvndcvqqvvellqerdivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofxB (B:)
    hmatnvtyqahhvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgip
    cytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnna
    rqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvl
    ktdscdvndcvqqvvellqerdivp