PDB entry 2ofw

View 2ofw on RCSB PDB site
Description: Crystal structure of the APSK domain of human PAPSS1 complexed with 2 APS molecules
Class: transferase
Keywords: nucleotide kinase, TRANSFERASE
Deposited on 2007-01-04, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: APS kinase domain of the PAPS synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-207)
      • conflict (35)
      • conflict (201)
      • conflict (206)
    Domains in SCOPe 2.06: d2ofwa_
  • Chain 'B':
    Compound: APS kinase domain of the PAPS synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-207)
      • conflict (35)
      • conflict (201)
      • conflict (206)
    Domains in SCOPe 2.06: d2ofwb_
  • Chain 'C':
    Compound: APS kinase domain of the PAPS synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-207)
      • conflict (35)
      • conflict (201)
      • conflict (206)
    Domains in SCOPe 2.06: d2ofwc_
  • Chain 'D':
    Compound: APS kinase domain of the PAPS synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-207)
      • conflict (35)
      • conflict (201)
      • conflict (206)
    Domains in SCOPe 2.06: d2ofwd_
  • Chain 'E':
    Compound: APS kinase domain of the PAPS synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-207)
      • conflict (35)
      • conflict (201)
      • conflict (206)
    Domains in SCOPe 2.06: d2ofwe_
  • Chain 'F':
    Compound: APS kinase domain of the PAPS synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-207)
      • conflict (35)
      • conflict (201)
      • conflict (206)
    Domains in SCOPe 2.06: d2ofwf_
  • Chain 'G':
    Compound: APS kinase domain of the PAPS synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-207)
      • conflict (35)
      • conflict (201)
      • conflict (206)
    Domains in SCOPe 2.06: d2ofwg_
  • Chain 'H':
    Compound: APS kinase domain of the PAPS synthetase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43252 (Start-207)
      • conflict (35)
      • conflict (201)
      • conflict (206)
    Domains in SCOPe 2.06: d2ofwh_
  • Heterogens: MG, ADX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ofwA (A:)
    qghmratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvch
    gipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdr
    nnarqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeape
    lvlktdscdvndcvqqvvellnerdilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofwA (A:)
    nvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipcytl
    dgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqih
    egaslpffevfvdaplhvceqrdkglykkarageikgftgidseyekpeapelvlktdsc
    dvndcvqqvvellnerdilp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ofwB (B:)
    qghmratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvch
    gipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdr
    nnarqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeape
    lvlktdscdvndcvqqvvellnerdilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofwB (B:)
    vsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipcytldgdnirqg
    lnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpff
    evfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcvq
    qvvellnerdilp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ofwC (C:)
    qghmratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvch
    gipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdr
    nnarqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeape
    lvlktdscdvndcvqqvvellnerdilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofwC (C:)
    ratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipc
    ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
    qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
    tdscdvndcvqqvvellnerdilp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ofwD (D:)
    qghmratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvch
    gipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdr
    nnarqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeape
    lvlktdscdvndcvqqvvellnerdilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofwD (D:)
    ratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipc
    ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
    qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
    tdscdvndcvqqvvellnerdilp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ofwE (E:)
    qghmratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvch
    gipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdr
    nnarqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeape
    lvlktdscdvndcvqqvvellnerdilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofwE (E:)
    atnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipcy
    tldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarq
    ihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlkt
    dscdvndcvqqvvellnerdilp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ofwF (F:)
    qghmratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvch
    gipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdr
    nnarqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeape
    lvlktdscdvndcvqqvvellnerdilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofwF (F:)
    ratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipc
    ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
    qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
    tdscdvndcvqqvvellnerdilp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ofwG (G:)
    qghmratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvch
    gipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdr
    nnarqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeape
    lvlktdscdvndcvqqvvellnerdilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofwG (G:)
    nvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipcytl
    dgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqih
    egaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktds
    cdvndcvqqvvellnerdilp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ofwH (H:)
    qghmratnvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvch
    gipcytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdr
    nnarqihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeape
    lvlktdscdvndcvqqvvellnerdilp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofwH (H:)
    vsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipcytldgdnirqg
    lnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpff
    evfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcvq
    qvvellnerdilp