PDB entry 2ofv

View 2ofv on RCSB PDB site
Description: crystal structure of aminoquinazoline 1 bound to Lck
Class: transferase
Keywords: Lck, Kinase domain, TRANSFERASE
Deposited on 2007-01-04, released 2007-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.274
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239
      • cloning artifact (5)
    Domains in SCOPe 2.05: d2ofva_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239
      • cloning artifact (273)
    Domains in SCOPe 2.05: d2ofvb_
  • Heterogens: 242, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ofvA (A:)
    tqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaf
    laeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldma
    aqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpik
    wtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdnc
    peelyqlmrlcwkerpedrptfdylrsvledfftate
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofvA (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqglaeanlmkqlqh
    qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee
    rnyihrdlraanilvsdtlsckiadfglaikwtapeainygtftiksdvwsfgillteiv
    thgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrptfdylrsvl
    edff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ofvB (B:)
    tqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaf
    laeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldma
    aqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpik
    wtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdnc
    peelyqlmrlcwkerpedrptfdylrsvledfftate
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofvB (B:)
    pwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgaflaeanlmkqlq
    hqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafie
    ernyihrdlraanilvsdtlsckiadfglarliedpikwtapeainygtftiksdvwsfg
    illteivthgripypiqnlegyrmvrpdncpeelyqlmrlcwkerpedrptfdylrsvle
    dfft