PDB entry 2ofu

View 2ofu on RCSB PDB site
Description: x-ray crystal structure of 2-aminopyrimidine carbamate 43 bound to Lck
Class: transferase
Keywords: Lck, Kinase domain, TRANSFERASE
Deposited on 2007-01-04, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (0-272)
      • modified residue (165)
    Domains in SCOPe 2.08: d2ofua_
  • Heterogens: SO4, 1N9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ofuA (A:)
pqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflae
anlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqi
aegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwta
peainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpee
lyqlmrlcwkerpedrptfdylrsvledfftat