PDB entry 2ofs

View 2ofs on RCSB PDB site
Description: Crystal structure of human CD59
Class: signaling protein
Keywords: complement inhibitor, SIGNALING PROTEIN
Deposited on 2007-01-04, released 2007-05-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cd59 glycoprotein
  Species: Homo sapiens [TaxId:9606]
  Gene: CD59
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13987 (1-74)
    • cloning artifact (0)
    • engineered (18)
  Domains in SCOPe 2.01: d2ofsa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ofsA (A:)
  flqcyncpnptadcktavqcssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
  tyycckkdlcnfneq