PDB entry 2ofp

View 2ofp on RCSB PDB site
Description: Crystal structure of Escherichia coli ketopantoate reductase in a ternary complex with NADP+ and pantoate
Class: oxidoreductase
Keywords: panE, APBA, ketopantoate reductase, ternary complex, OXIDOREDUCTASE
Deposited on 2007-01-04, released 2007-01-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.159
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketopantoate reductase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: panE, apbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9J4 (17-End)
      • expression tag (16)
    Domains in SCOPe 2.01: d2ofpa1, d2ofpa2
  • Chain 'B':
    Compound: Ketopantoate reductase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: panE, apbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9J4 (17-End)
      • expression tag (16)
    Domains in SCOPe 2.01: d2ofpb1, d2ofpb2
  • Heterogens: ACT, NAP, PAF, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ofpA (A:)
    mrgshhhhhhglvprgsmkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlve
    tdgsifnesltandpdflatsdlllvtlkawqvsdavkslastlpvttpillihngmgti
    eelqniqqpllmgttthaarrdgnviihvangithigparqqdgdysyladilqtvlpdv
    awhnniraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhts
    aedlrdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfe
    mvkrkeseyerigtglprpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofpA (A:)
    smkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpd
    flatsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttt
    haarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhnniraelwrklav
    ncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedlrdyvmqvidata
    enissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkrkesey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ofpB (B:)
    mrgshhhhhhglvprgsmkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlve
    tdgsifnesltandpdflatsdlllvtlkawqvsdavkslastlpvttpillihngmgti
    eelqniqqpllmgttthaarrdgnviihvangithigparqqdgdysyladilqtvlpdv
    awhnniraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhts
    aedlrdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfe
    mvkrkeseyerigtglprpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofpB (B:)
    smkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpd
    flatsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttt
    haarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhnniraelwrklav
    ncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedlrdyvmqvidata
    enissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkrkeseye