PDB entry 2ofm

View 2ofm on RCSB PDB site
Description: 1.11 A Crystal Structure of Apo Nitrophorin 4 From Rhodnius Prolixus
Class: transport protein
Keywords: lipocalin, beta barrel, absent cofactor, TRANSPORT PROTEIN
Deposited on 2007-01-03, released 2007-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.11 Å
R-factor: 0.148
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Nitrophorin-4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
  Domains in SCOPe 2.08: d2ofmx_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ofmX (X:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk