PDB entry 2ofi

View 2ofi on RCSB PDB site
Description: Crystal Structure of 3-methyladenine DNA Glycosylase I (TAG) bound to DNA/3mA
Class: 3-methyladenine DNA glycosylase I/DNA
Keywords: 3-Methyladenine, DNA repair, Glycosylase, Base Excision, Helix-hairpin-Helix, 3-METHYLADENINE DNA GLYCOSYLASE I-DNA COMPLEX
Deposited on 2007-01-03, released 2007-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-methyladenine DNA glycosylase I, constitutive
  Species: SALMONELLA TYPHI [TaxId:601]
  Gene: TAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z2A5 (0-183)
    • modified residue (0)
    • modified residue (33)
    • modified residue (70)
    • modified residue (104)
    • modified residue (165)
  Domains in SCOPe 2.08: d2ofia_
• Chain 'B':
  Compound: 5'-d(*cp*cp*gp*tp*tp*ap*gp*tp*cp*cp*gp*c)-3'
  
• Chain 'C':
  Compound: 5'-d(*cp*gp*gp*ap*cp*tp*(3dr)p*ap*cp*gp*gp*g)-3'
  
• Heterogens: ZN, NA, ADK, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ofiA (A:)
  mqrcdwvsqdplyiayhdnewgvpetdsrklfemiclegqqaglswitvlkkrenyracf
  hqfdpiriaamqeedverllqntgiirhrgkiqaiisnarawlameqngesfadfvwsfv
  dgqpqitqaasldkiptstpasdalakalkkrgfkfvgtticysfmqacglvndhitgcf
  chpg
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.