PDB entry 2ofh

View 2ofh on RCSB PDB site
Description: Solution structure of the n-terminal domain of the zinc(II) ATPase ziaa in its apo form
Class: hydrolase, membrane protein
Keywords: ferredoxin-like fold; beta-alpha-beta-beta-alpha-beta; structural genomics; spine, hydrolase, membrane protein
Deposited on 2007-01-03, released 2007-12-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Zinc-transporting ATPase
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ZIAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ofhx_

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2ofhX (X:)
    mtqssplktqqmqvggmdctscklkiegslerlkgvaeasvtvatgrltvtydpkqvsei
    tiqeriaalgytlaepkssvtlnghkhphshreeghshshgagefnlkqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofhX (X:)
    plktqqmqvggmdctscklkiegslerlkgvaeasvtvatgrltvtydpkqvseitiqer
    iaalgytlaep