PDB entry 2ofd

View 2ofd on RCSB PDB site
Description: The Crystal Structure of Sclerotium rolfsii lectin in complex with N-acetyl-D-galactosamine
Class: sugar binding protein
Keywords: Lectin, dual specificity, SUGAR BINDING PROTEIN
Deposited on 2007-01-03, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.163
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sclerotium rolfsii lectin
    Species: Athelia rolfsii [TaxId:39291]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OFD (Start-140)
    Domains in SCOPe 2.07: d2ofda_
  • Chain 'B':
    Compound: Sclerotium rolfsii lectin
    Species: Athelia rolfsii [TaxId:39291]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OFD (Start-140)
    Domains in SCOPe 2.07: d2ofdb_
  • Heterogens: NGA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ofdA (A:)
    tykitvrvyqtnpnaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
    esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyevknakgr
    nfeivyteaegndlhanliig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ofdB (B:)
    tykitvrvyqtnpnaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
    esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyevknakgr
    nfeivyteaegndlhanliig