PDB entry 2ofa

View 2ofa on RCSB PDB site
Description: Crystal structure of apo AVR4 (R112L,C122S)
Class: ligand binding protein
Keywords: avidin, streotavidin, AVR4, high affinity, pseudo catalysis, LIGAND BINDING PROTEIN
Deposited on 2007-01-03, released 2007-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.173
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734
      • engineered (111)
      • engineered (121)
    Domains in SCOPe 2.07: d2ofaa1, d2ofaa2
  • Chain 'B':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734
      • engineered (111)
      • engineered (121)
    Domains in SCOPe 2.07: d2ofab1, d2ofab2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ofaA (A:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatlvgynnftr
    lstvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofaA (A:)
    kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf
    gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatlvgynnftrls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ofaB (B:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatlvgynnftr
    lstvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofaB (B:)
    csltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptfg
    ftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatlvgynnftrls