PDB entry 2of8

View 2of8 on RCSB PDB site
Description: Crystal structure of AVR4 (D39A/C122S)-BNA complex
Class: ligand binding protein
Keywords: avidin, streptavidin, AVR4, high affinity, pseudo-catalysis, LIGAND BINDING PROTEIN
Deposited on 2007-01-03, released 2007-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.164
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734
      • engineered (38)
      • engineered (121)
    Domains in SCOPe 2.07: d2of8a1, d2of8a2
  • Chain 'B':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734
      • engineered (38)
      • engineered (121)
    Domains in SCOPe 2.07: d2of8b1, d2of8b2
  • Heterogens: BNI, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2of8A (A:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavaanpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftr
    lstvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2of8A (A:)
    kcsltgkwtnnlgsimtiravnsrgeftgtyltavaanpgnitlspllgiqhkrasqptf
    gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2of8B (B:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavaanpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftr
    lstvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2of8B (B:)
    kcsltgkwtnnlgsimtiravnsrgeftgtyltavaanpgnitlspllgiqhkrasqptf
    gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrls