PDB entry 2of1

View 2of1 on RCSB PDB site
Description: Cryogenic crystal structure of the Staphylococcal Nuclease variant truncated Delta+PHS I92W
Class: hydrolase
Keywords: OB-fold, HYDROLASE
Deposited on 2007-01-02, released 2008-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • see remark 999 (43-44)
      • see remark 999 (57)
      • see remark 999 (85)
      • see remark 999 (90)
      • see remark 999 (94)
      • see remark 999 (103)
      • see remark 999 (110)
      • see remark 999 (120-121)
    Domains in SCOPe 2.07: d2of1a_
  • Heterogens: CA, DMS, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2of1A (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkamv
    enakkievefdkgqrtdkygrglaywyadgamvnealvrqglaavayvykgnntheqllr
    aaeaqakkeklniwsedn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2of1A (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkamv
    enakkievefdkgqrtdkygrglaywyadgamvnealvrqglaavayvykgnntheqllr
    aaeaqakkeklniwse