PDB entry 2oez

View 2oez on RCSB PDB site
Description: Protein of Unknown Function (DUF1342) from Vibrio parahaemolyticus
Class: structural genomics, unknown function
Keywords: immunoglobulin fold, alpha-structure, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2007-01-02, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0289 protein VP2528
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP2528
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87LT3 (3-246)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (103)
      • modified residue (207)
      • modified residue (214)
      • modified residue (227)
    Domains in SCOPe 2.08: d2oeza1, d2oeza2
  • Chain 'B':
    Compound: UPF0289 protein VP2528
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP2528
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87LT3 (3-246)
      • modified residue (50)
      • modified residue (103)
      • modified residue (207)
      • modified residue (214)
      • modified residue (227)
    Domains in SCOPe 2.08: d2oezb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oezA (A:)
    snatthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiql
    kselakdlekqrlsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrfls
    sirqrfnlpggsccfdlpalhywlhlpierkkhdanqwqkslkplsdaltlwlklaretg
    hfkaqiaragffqsdadeanilrlhipmkygvypmisghknrfaikfmafengqacsqdv
    efelavc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oezA (A:)
    atthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiqlks
    elakdlekqrlsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrflssi
    rqrfnlccfdlpalhywlhlpierkkhdanqwqkslkplsdaltlwlklaretghfkaqi
    aragffqsdadeanilrlhipmkygvypmisghknrfaikfmafengqacsqdvefelav
    c
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oezB (B:)
    snatthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiql
    kselakdlekqrlsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrfls
    sirqrfnlpggsccfdlpalhywlhlpierkkhdanqwqkslkplsdaltlwlklaretg
    hfkaqiaragffqsdadeanilrlhipmkygvypmisghknrfaikfmafengqacsqdv
    efelavc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oezB (B:)
    tthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiqlkse
    lakdlekqrlsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrflssir
    qrfnlpggccfdlpalhywlhlpierkkhdanqwqkslkplsdaltlwlklaretghfka
    qiaragffqsdadeanilrlhipmkygvypmisghknrfaikfmafengqacsqdvefel
    avc