PDB entry 2oem

View 2oem on RCSB PDB site
Description: Crystal structure of a rubisco-like protein from Geobacillus kaustophilus liganded with Mg2+ and 2,3-diketohexane 1-phosphate
Class: isomerase
Keywords: Rubisco-like protein, "enolase", ISOMERASE
Deposited on 2006-12-30, released 2007-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
    Species: Geobacillus kaustophilus [TaxId:1462]
    Gene: mtnW
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5L1E2
      • modified residue (172)
    Domains in SCOPe 2.06: d2oema1
  • Chain 'B':
    Compound: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
    Species: Geobacillus kaustophilus [TaxId:1462]
    Gene: mtnW
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5L1E2 (Start-412)
      • modified residue (172)
    Domains in SCOPe 2.06: d2oemb1, d2oemb2
  • Heterogens: MG, 1AE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oemA (A:)
    msavmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgese
    rvnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqf
    pgprfgidgirdrvgvhnrpllmsifkgmigrdlayltselkkqalggvdlvkddeilfd
    sellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnv
    faygldvlqalredeeiavpimahpafsgavtpsefygvapslwlgkllrlagadfvlfp
    spygsvalereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnagg
    gihghpdgaigggrafraaidavlagrplraaaaenealqkaidrwgvvevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oemA (A:)
    savmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgeser
    vnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqfp
    gprfgidgirdrvgvhnrpllmsifkgmigrdlayltselkkqalggvdlvkddeilfds
    ellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnvf
    aygldvlqalredeeiavpimahpafsgavtpsefygvapslwlgkllrlagadfvlfps
    pygsvalereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnaggg
    ihghpdgaigggrafraaidavlagrplraaaaenealqkaidrwgvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oemB (B:)
    msavmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgese
    rvnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqf
    pgprfgidgirdrvgvhnrpllmsifkgmigrdlayltselkkqalggvdlvkddeilfd
    sellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnv
    faygldvlqalredeeiavpimahpafsgavtpsefygvapslwlgkllrlagadfvlfp
    spygsvalereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnagg
    gihghpdgaigggrafraaidavlagrplraaaaenealqkaidrwgvvevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oemB (B:)
    savmatyllhdetdirkkaegialgltigtwtdlpaleqeqlrkhkgevvaieelgeser
    vnayfgkrlkraivkiayptvnfsadlpallvttfgklsldgevrlldlefpdewkrqfp
    gprfgidgirdrvgvhnrpllmsifkgmigrdlayltselkkqalggvdlvkddeilfds
    ellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnvf
    aygldvlqalredeeiavpimahpafsgavtpsefygvapslwlgkllrlagadfvlfps
    pygsvalereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnaggg
    ihghpdgaigggrafraaidavlagrplraaaaenealqkaidrwgvvevea