PDB entry 2oei

View 2oei on RCSB PDB site
Description: Crystal structure of human FE65-WW domain in complex with human Mena peptide
Class: protein binding
Keywords: WW domain, FE65, human Mena, PROTEIN BINDING
Deposited on 2006-12-29, released 2007-07-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.194
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amyloid beta A4 protein-binding family B member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: APBB1, FE65
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00213 (1-End)
    • expression tag (0)
  Domains in SCOPe 2.03: d2oeia1
• Chain 'B':
  Compound: poly-proline peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2OEI (0-8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2oeiA (A:)
  gsdlpagwmrvqdtsgtyywhiptgttqweppgrasps
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2oeiA (A:)
  gsdlpagwmrvqdtsgtyywhiptgttqweppgrasp
  

  
  
• Chain 'B':
  No sequence available.