PDB entry 2oei

View 2oei on RCSB PDB site
Description: Crystal structure of human FE65-WW domain in complex with human Mena peptide
Class: protein binding
Keywords: WW domain, FE65, human Mena, PROTEIN BINDING
Deposited on 2006-12-29, released 2007-07-10
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-25, with a file datestamp of 2007-09-21.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.194
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 protein-binding family B member 1
    Species: HOMO SAPIENS
    Gene: APBB1, FE65
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00213 (1-End)
      • expression tag (0)
    Domains in SCOP 1.75: d2oeia1
  • Chain 'B':
    Compound: poly-proline peptide
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oeiA (A:)
    gsdlpagwmrvqdtsgtyywhiptgttqweppgrasps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oeiA (A:)
    gsdlpagwmrvqdtsgtyywhiptgttqweppgrasp
    

  • Chain 'B':
    No sequence available.