PDB entry 2oed

View 2oed on RCSB PDB site
Description: GB3 solution structure obtained by refinement of X-ray structure with dipolar couplings
Class: immune system
Keywords: immune system, residual dipolar couplings
Deposited on 2006-12-29, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Immunoglobulin G-binding protein G
  Species: Streptococcus sp. 'group G' [TaxId:1320]
  Gene: spg
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19909 (2-55)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2oeda2, d2oeda3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oedA (A:)
  mqyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte