PDB entry 2odg

View 2odg on RCSB PDB site
Description: Complex of barrier-to-autointegration factor and LEM-domain of emerin
Class: membrane protein, protein binding
Keywords: inner nuclear membrane protein, lem-domain baf multidimensional nmr dipolar couplings, membrane protein, protein binding
Deposited on 2006-12-22, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barrier-to-autointegration factor
    Species: Homo sapiens [TaxId:9606]
    Gene: BANF1, BAF, BCRG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odga_
  • Chain 'B':
    Compound: barrier-to-autointegration factor
    Species: Homo sapiens [TaxId:9606]
    Gene: BANF1, BAF, BCRG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odgb_
  • Chain 'C':
    Compound: emerin
    Species: Homo sapiens [TaxId:9606]
    Gene: EMD, EDMD, STA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50402 (1-46)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2odgc2, d2odgc3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2odgA (A:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2odgB (B:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2odgC (C:)
    hdnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr