PDB entry 2odf

View 2odf on RCSB PDB site
Description: The crystal structure of gene product Atu2144 from Agrobacterium tumefaciens
Class: structural genomics, unknown function
Keywords: Structural genomics, Agrobacterium tumefaciens, unknown function, PSI-2, MCSG, Protein Structure Initiative, Midwest Center for Structural Genomics
Deposited on 2006-12-22, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Atu2144
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odfa1
  • Chain 'B':
    Compound: Hypothetical protein Atu2144
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odfb_
  • Chain 'C':
    Compound: Hypothetical protein Atu2144
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odfc_
  • Chain 'D':
    Compound: Hypothetical protein Atu2144
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odfd_
  • Chain 'E':
    Compound: Hypothetical protein Atu2144
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odfe_
  • Chain 'F':
    Compound: Hypothetical protein Atu2144
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odff_
  • Chain 'G':
    Compound: Hypothetical protein Atu2144
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odfg_
  • Chain 'H':
    Compound: Hypothetical protein Atu2144
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odfh_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2odfA (A:)
    mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdp
    galavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerf
    artsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrla
    damlagaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaai
    agflhelmgkalssiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2odfA (A:)
    rffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalav
    arllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsa
    lyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamla
    gaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflh
    elmgkalssiee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2odfB (B:)
    mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdp
    galavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerf
    artsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrla
    damlagaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaai
    agflhelmgkalssiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2odfB (B:)
    tvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpg
    alavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfa
    rtsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyfreveigilhdndsrladaml
    agaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagfl
    helmgkalssie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2odfC (C:)
    mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdp
    galavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerf
    artsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrla
    damlagaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaai
    agflhelmgkalssiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2odfC (C:)
    ffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalava
    rllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsal
    yvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamlag
    aegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflhe
    lmgkalssi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2odfD (D:)
    mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdp
    galavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerf
    artsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrla
    damlagaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaai
    agflhelmgkalssiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2odfD (D:)
    ffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalava
    rllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsal
    yvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamlag
    aegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflhe
    lmgkalssie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2odfE (E:)
    mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdp
    galavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerf
    artsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrla
    damlagaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaai
    agflhelmgkalssiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2odfE (E:)
    rffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalav
    arllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsa
    lyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamla
    gaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflh
    elmgkalssie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2odfF (F:)
    mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdp
    galavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerf
    artsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrla
    damlagaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaai
    agflhelmgkalssiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2odfF (F:)
    rffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalav
    arllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsa
    lyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamla
    gaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflh
    elmgkalssie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2odfG (G:)
    mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdp
    galavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerf
    artsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrla
    damlagaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaai
    agflhelmgkalssiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2odfG (G:)
    ffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalava
    rllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsal
    yvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamlag
    aegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflhe
    lmgkalssie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2odfH (H:)
    mtvrsrffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdp
    galavarllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerf
    artsalyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrla
    damlagaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaai
    agflhelmgkalssiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2odfH (H:)
    rffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalav
    arllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsa
    lyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamla
    gaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflh
    elmgkalssie