PDB entry 2odd

View 2odd on RCSB PDB site
Description: Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor
Class: metal binding protein
Keywords: MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, METAL BINDING PROTEIN
Deposited on 2006-12-22, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein CBFA2T1
  Species: Homo sapiens [TaxId:9606]
  Gene: AML1-ETO
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q06455 (14-63)
  Domains in SCOPe 2.06: d2odda_
• Chain 'B':
  Compound: smrt
  Species: Homo sapiens [TaxId:9606]
  Gene: SMRT
  Database cross-references and differences (RAF-indexed):
  • PDB 2ODD (Start-16)
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2oddA (A:)
  enlyfqgenlyfqgdssescwncgrkasetcsgcntarycgsfcqhkdwekhhhicgqtl
  qaqq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2oddA (A:)
  dssescwncgrkasetcsgcntarycgsfcqhkdwekhhhicgqtlqaqq
  

  
  
• Chain 'B':
  No sequence available.