PDB entry 2odd

View 2odd on RCSB PDB site
Description: Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor
Class: metal binding protein
Keywords: MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, METAL BINDING PROTEIN
Deposited on 2006-12-22, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein CBFA2T1
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1-ETO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2odda_
  • Chain 'B':
    Compound: smrt
    Species: Homo sapiens [TaxId:9606]
    Gene: SMRT
    Database cross-references and differences (RAF-indexed):
    • PDB 2ODD (Start-16)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oddA (A:)
    enlyfqgenlyfqgdssescwncgrkasetcsgcntarycgsfcqhkdwekhhhicgqtl
    qaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oddA (A:)
    dssescwncgrkasetcsgcntarycgsfcqhkdwekhhhicgqtlqaqq
    

  • Chain 'B':
    No sequence available.