PDB entry 2od8

View 2od8 on RCSB PDB site
Description: Structure of a peptide derived from Cdc9 bound to PCNA
Class: protein binding
Keywords: homotrimer, PCNA-peptide complex, PCNA, PROTEIN BINDING
Deposited on 2006-12-21, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: POL30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2od8a1, d2od8a2
  • Chain 'B':
    Compound: DNA ligase I, mitochondrial precursor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2od8A (A:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2od8A (A:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfn
    

  • Chain 'B':
    No sequence available.