PDB entry 2od7

View 2od7 on RCSB PDB site
Description: Crystal Structure of yHst2 bound to the intermediate analogue ADP-HPD, and and aceylated H4 peptide
Class: hydrolase
Keywords: Zn binding domain, Rossmann fold, HYDROLASE
Deposited on 2006-12-21, released 2007-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.222
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase HST2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53686 (14-End)
      • cloning artifact (11-13)
    Domains in SCOPe 2.06: d2od7a1, d2od7a2
  • Chain 'B':
    Compound: Acetylated histone H4 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2OD7 (0-End)
  • Heterogens: ZN, A1R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2od7A (A:)
    mrgshhhhhhgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrs
    pgtglyhnlarlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdk
    dvlkrvytqnidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikd
    fvkcdvcgelvkpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtsl
    avypfaslpeeiprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqed
    fekiltaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2od7A (A:)
    masmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlar
    lklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqni
    dtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelv
    kpaivffgedlpdsfsetwlndsewlrekiqqplvivvgtslavypfaslpeeiprkvkr
    vlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta
    

  • Chain 'B':
    No sequence available.