PDB entry 2od1

View 2od1 on RCSB PDB site
Description: Solution structure of the MYND domain from human AML1-ETO
Class: metal binding protein
Keywords: zinc finger, cross-braced topology, METAL BINDING PROTEIN
Deposited on 2006-12-21, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein CBFA2T1
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1-ETO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2od1a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2od1A (A:)
    gspnsgspnsdssescwncgrkasetcsgcntarycgsfcqhkdwekhhhicgqtlqaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2od1A (A:)
    dssescwncgrkasetcsgcntarycgsfcqhkdwekhhhicgqtlqaqq