PDB entry 2od0

View 2od0 on RCSB PDB site
Description: The crystal structure of gene product VP1028 from Vibrio parahaemolyticus
Class: structural genomics, unknown function
Keywords: Structural genomics, Vibrio parahaemolyticus, unknown function, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-12-21, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein VP1028
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP1028
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87QX1 (Start-104)
      • modified residue (9)
      • modified residue (23)
      • modified residue (35)
    Domains in SCOPe 2.08: d2od0a1
  • Chain 'B':
    Compound: Hypothetical protein VP1028
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP1028
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87QX1
      • modified residue (9)
      • modified residue (23)
      • modified residue (35)
    Domains in SCOPe 2.08: d2od0b_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2od0A (A:)
    mdkpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetq
    glkpyvykkrgfpvvtkyyaisselwessdrlievakkslenakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2od0A (A:)
    kpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetqgl
    kpyvykkrgfpvvtkyyaisselwessdrlievakkslenakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2od0B (B:)
    mdkpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetq
    glkpyvykkrgfpvvtkyyaisselwessdrlievakkslenakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2od0B (B:)
    kpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetqgl
    kpyvykkrgfpvvtkyyaisselwessdrlievakkslenak