PDB entry 2oci

View 2oci on RCSB PDB site
Description: Crystal structure of valacyclovir hydrolase complexed with a product analogue
Class: hydrolase
Keywords: alpha beta hydrolase fold
Deposited on 2006-12-20, released 2008-02-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Valacyclovir hydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: BPHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ocia_
  • Heterogens: MN, MG, TYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ociA (A:)
    svtsakvavngvqlhyqqtgegdhavlllpgmlgsgetdfgpqlknlnkklftvvawdpr
    gyghsrppdrdfpadfferdakdavdlmkalkfkkvsllgwsdggitaliaaakypsyih
    kmviwganayvtdedsmiyegirdvskwsertrkplealygydyfartcekwvdgirqfk
    hlpdgnicrhllprvqcpalivhgekdplvprfhadfihkhvkgsrlhlmpegkhnlhlr
    fadefnklaedflq