PDB entry 2ocd

View 2ocd on RCSB PDB site
Description: Crystal structure of L-asparaginase I from Vibrio cholerae O1 biovar eltor str. N16961
Class: hydrolase
Keywords: L-asparaginase I, SAD, MCSG, PSI-2, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, HYDROLASE
Deposited on 2006-12-20, released 2007-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.179
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-asparaginase I
    Species: Vibrio cholerae [TaxId:666]
    Gene: O1 biovar eltor
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQK3 (Start-336)
      • modified residue (16)
      • modified residue (30)
      • modified residue (37)
      • modified residue (45)
      • modified residue (57)
      • modified residue (62)
      • modified residue (93)
      • modified residue (103)
      • modified residue (155)
      • modified residue (217)
      • modified residue (237)
      • modified residue (280)
      • modified residue (300)
      • modified residue (326)
      • modified residue (334)
    Domains in SCOPe 2.07: d2ocda1
  • Chain 'B':
    Compound: L-asparaginase I
    Species: Vibrio cholerae [TaxId:666]
    Gene: O1 biovar eltor
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQK3 (Start-336)
      • modified residue (16)
      • modified residue (30)
      • modified residue (37)
      • modified residue (45)
      • modified residue (57)
      • modified residue (62)
      • modified residue (93)
      • modified residue (103)
      • modified residue (155)
      • modified residue (217)
      • modified residue (237)
      • modified residue (280)
      • modified residue (300)
      • modified residue (326)
      • modified residue (334)
    Domains in SCOPe 2.07: d2ocdb_
  • Chain 'C':
    Compound: L-asparaginase I
    Species: Vibrio cholerae [TaxId:666]
    Gene: O1 biovar eltor
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQK3 (Start-336)
      • modified residue (16)
      • modified residue (30)
      • modified residue (37)
      • modified residue (45)
      • modified residue (57)
      • modified residue (62)
      • modified residue (93)
      • modified residue (103)
      • modified residue (155)
      • modified residue (217)
      • modified residue (237)
      • modified residue (280)
      • modified residue (300)
      • modified residue (326)
      • modified residue (334)
    Domains in SCOPe 2.07: d2ocdc_
  • Chain 'D':
    Compound: L-asparaginase I
    Species: Vibrio cholerae [TaxId:666]
    Gene: O1 biovar eltor
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQK3 (Start-336)
      • modified residue (16)
      • modified residue (30)
      • modified residue (37)
      • modified residue (45)
      • modified residue (57)
      • modified residue (62)
      • modified residue (93)
      • modified residue (103)
      • modified residue (155)
      • modified residue (217)
      • modified residue (237)
      • modified residue (280)
      • modified residue (300)
      • modified residue (326)
      • modified residue (334)
    Domains in SCOPe 2.07: d2ocdd_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ocdA (A:)
    markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmds
    sdmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqip
    ladlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppl
    leaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamil
    ltfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgyd
    mtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ocdA (A:)
    arkhiyiaytggtigmkksdpvagfmekqlasmpefhrpemplftiheydplmdssdmtp
    adwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladlr
    sdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlpplleagi
    nielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfgv
    gnapqnpellaqlkaasergvivvnltqclagkvnmggcaladagvisgydmtpeaalak
    lhyllsqnlsyeevkakmqqvlrgemtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ocdB (B:)
    markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmds
    sdmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqip
    ladlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppl
    leaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamil
    ltfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgyd
    mtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ocdB (B:)
    arkhiyiaytggtigmkksdvpvagfmekqlasmpefhrpemplftiheydplmdssdmt
    padwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladl
    rsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlpplleag
    inielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfg
    vgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgydmtpe
    aalaklhyllsqnlsyeevkakmqqvlrgemtl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ocdC (C:)
    markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmds
    sdmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqip
    ladlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppl
    leaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamil
    ltfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgyd
    mtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ocdC (C:)
    arkhiyiaytggtigmkksdvpvagfmekqlasmpefhrpemplftiheydplmdssdmt
    padwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladl
    rsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshagfsafsspnlpplleagi
    nielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfgv
    gnapqnpellaqlkaasergvivvnltqclagkvnmggcaladagvisgydmtpeaalak
    lhyllsqnlsyeevkakmqqvlrgemtl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ocdD (D:)
    markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmds
    sdmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqip
    ladlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppl
    leaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamil
    ltfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgyd
    mtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ocdD (D:)
    arkhiyiaytggtigmkksvpvagfmekqlasmpefhrpemplftiheydplmdssdmtp
    adwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladlr
    sdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlpplleagi
    nielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfgv
    gnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgydmtpea
    alaklhyllsqnlsyeevkakmqqvlrgemtl