PDB entry 2oc6

View 2oc6 on RCSB PDB site
Description: Crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 A resolution
Class: unknown function
Keywords: Secretion chaperone-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2006-12-20, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YdhG protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ydhG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q797E6 (1-123)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (44)
      • modified residue (106)
    Domains in SCOPe 2.08: d2oc6a1, d2oc6a2
  • Chain 'B':
    Compound: YdhG protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ydhG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q797E6 (1-123)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (44)
      • modified residue (106)
    Domains in SCOPe 2.08: d2oc6b2, d2oc6b3
  • Heterogens: SO4, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2oc6A (A:)
gmdvfseylagiadpfhrerteevltwiknkypnlhteikwnqpmftdhgtfiigfsvsk
khlavapekvtiahveddivkagydyteqliripwngpvdytllekmiefnildkadcst
fwrk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2oc6B (B:)
gmdvfseylagiadpfhrerteevltwiknkypnlhteikwnqpmftdhgtfiigfsvsk
khlavapekvtiahveddivkagydyteqliripwngpvdytllekmiefnildkadcst
fwrk