PDB entry 2obj

View 2obj on RCSB PDB site
Description: Crystal structure of human PIM-1 Kinase in complex with inhibitor
Class: transferase
Keywords: PIM, PIM-1, PIM1, human PIM-1 Kinase, Serine/threonine kinase, kinase inhibitor complex, Pyridone, kinase inhibitor, TRANSFERASE
Deposited on 2006-12-19, released 2007-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11309
      • modified residue (280)
    Domains in SCOPe 2.05: d2obja_
  • Heterogens: VRV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2objA (A:)
    mgsshhhhhhssglvprgshmllskinslahlraapcndlhatklapgkekeplesqyqv
    gpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkkvssgf
    sgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchn
    cgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhg
    rsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrpt
    feeiqnhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2objA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh