PDB entry 2obh

View 2obh on RCSB PDB site
Description: Centrin-XPC peptide
Class: cell cycle
Keywords: DNA repair complex ef hand superfamily protein-peptide complex, cell cycle
Deposited on 2006-12-19, released 2007-10-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Centrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CETN2, CALT, CEN2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2obha_
  • Chain 'B':
    Compound: Centrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CETN2, CALT, CEN2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2obhb_
  • Chain 'C':
    Compound: DNA-repair protein complementing XP-C cells
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA-repair protein complementing XP-C cells
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2obhA (A:)
    teeqkqeireafdlfdadgtgtidvkelkvamralgfepkkeeikkmiseidkegtgkmn
    fgdfltvmtqkmsekdtkeeilkafklfdddetgkisfknlkrvakelgenltdeelqem
    ideadrdgdgevseqeflrimkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2obhB (B:)
    teeqkqeireafdlfdadgtgtidvkelkvamralgfepkkeeikkmiseidkegtgkmn
    fgdfltvmtqkmsekdtkeeilkafklfdddetgkisfknlkrvakelgenltdeelqem
    ideadrdgdgevseqeflrimkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.