PDB entry 2ob7

View 2ob7 on RCSB PDB site
Description: Structure of tmRNA-(SmpB)2 complex as inferred from cryo-EM
Class: RNA binding protein/RNA
Keywords: tmRNA, SmpB, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2006-12-18, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transfer-messenger RNA
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'B':
    Compound: SsrA-binding protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OB7
    Domains in SCOPe 2.08: d2ob7b1
  • Chain 'C':
    Compound: SsrA-binding protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OB7
    Domains in SCOPe 2.08: d2ob7c1
  • Chain 'D':
    Compound: 16S ribosomal RNA
    Species: Thermus thermophilus [TaxId:274]

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ob7B (B:)
    gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
    lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
    lialakgkklydrrrelkekamkrelerefkgkihl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ob7B (B:)
    sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
    nlyiapynhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvlialakgk
    kl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ob7C (C:)
    gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
    lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
    lialakgkklydrrrelkekamkrelerefkgkihl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ob7C (C:)
    sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
    nlyiapykhanhdplrkrklllhkreimrlygkvqeiiplklywknnkvkvlial
    

  • Chain 'D':
    No sequence available.